Recombinant Full Length Bovine Fatty Acyl-Coa Reductase 2(Far2) Protein, His-Tagged
Cat.No. : | RFL21482BF |
Product Overview : | Recombinant Full Length Bovine Fatty acyl-CoA reductase 2(FAR2) Protein (Q0P5J1) (1-515aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-515) |
Form : | Lyophilized powder |
AA Sequence : | MSMIAAFYGGKSILITGATGFMGKVLMEKLFRTSPDLKVVYILVRPKQGQTLQQRVFQIL DSKLFEKVKEVCPNVHEKIRAISADLNQNDFAISKEDMKELLSHTNIIFHCAATVRFDDH LRHAVQLNVTATQQLLLMASQMPKLEAFIHISTAFSNCNLKHIDEVVYPCPVEPKKIIDS MEWLDDAIIDEITPKLIGDWPNTYTYTKALGEVVVQQEGGNLNIAIIRPSIMGATWQEPF PGWVDNLNGPSGLIIAAGKGFLRSIRATPMAVADLIPADTVVNLTLAVGWYTAVHRPKST LVYHCTSGNLNPCNWGKMGLQVLATFEKIPFERAFRRPNADFTTNNITTHYWNAVSHRAP AIIYDFYLRLTGRKPRMTKLMNRLLRTLSMLEYFVNRSWEWSTYNTEMLMSELSPEDQRV FNFDVRQLNWLEYIENYVLGVKKYLLKEDMAGIPEAKQHLKRLRNIHYLFNTALFLIAWR LLIARSQVARNVWFFIVSFCYKFLSYFRASSTLNV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | FAR2 |
Synonyms | FAR2; Fatty acyl-CoA reductase 2 |
UniProt ID | Q0P5J1 |
◆ Recombinant Proteins | ||
RFL32141HF | Recombinant Full Length Human Fatty Acyl-Coa Reductase 2(Far2) Protein, His-Tagged | +Inquiry |
FAR2-5679M | Recombinant Mouse FAR2 Protein | +Inquiry |
FAR2-3839H | Recombinant Human FAR2 Protein, GST-tagged | +Inquiry |
FAR2-1466R | Recombinant Rhesus Macaque FAR2 Protein, His (Fc)-Avi-tagged | +Inquiry |
FAR2-301338H | Recombinant Human FAR2 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAR2-6328HCL | Recombinant Human FAR2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FAR2 Products
Required fields are marked with *
My Review for All FAR2 Products
Required fields are marked with *
0
Inquiry Basket