Recombinant Human FAR2 protein, GST-tagged
Cat.No. : | FAR2-301338H |
Product Overview : | Recombinant Human FAR2 (52-104 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Leu52-Cys104 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization |
AA Sequence : | LQQRVFQILDSKLFEKVKEVCPNVHEKIRAIYADLNQNDFAISKEDMQELLSC |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | FAR2 fatty acyl CoA reductase 2 [ Homo sapiens ] |
Official Symbol | FAR2 |
Synonyms | MLSTD1; SDR10E2 |
Gene ID | 55711 |
mRNA Refseq | NM_018099.3 |
Protein Refseq | NP_060569.3 |
UniProt ID | Q96K12 |
◆ Recombinant Proteins | ||
FAR2-301338H | Recombinant Human FAR2 protein, GST-tagged | +Inquiry |
FAR2-2885H | Recombinant Human FAR2 protein, His-tagged | +Inquiry |
FAR2-1466R | Recombinant Rhesus Macaque FAR2 Protein, His (Fc)-Avi-tagged | +Inquiry |
FAR2-3116M | Recombinant Mouse FAR2 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL21482BF | Recombinant Full Length Bovine Fatty Acyl-Coa Reductase 2(Far2) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAR2-6328HCL | Recombinant Human FAR2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FAR2 Products
Required fields are marked with *
My Review for All FAR2 Products
Required fields are marked with *
0
Inquiry Basket