Recombinant Full Length Bovine Mitochondrial Uncoupling Protein 3(Ucp3) Protein, His-Tagged
Cat.No. : | RFL34178BF |
Product Overview : | Recombinant Full Length Bovine Mitochondrial uncoupling protein 3(UCP3) Protein (O77792) (1-311aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-311) |
Form : | Lyophilized powder |
AA Sequence : | MVGLQPSERPPTTSVKFLAAGTAACFADLLTFPLDTAKVRLQIQGENQAALAARSAQYRG VLGTILTMVRTEGPRSLYSGLVAGLQRQMSFASIRIGLYDSVKQFYTPKGSDHSSIITRI LAGCTTGAMAVTCAQPTDVVKIRFQASMHTGLGGNRKYSGTMDAYRTIAREEGVRGLWKG ILPNITRNAIVNCGEMVTYDIIKEKLLDYHLLTDNFPCHFVSAFGAGFCATLVASPVDVV KTRYMNSPPGQYHSPFDCMLKMVTQEGPTAFYKGFTPSFLRLGSWNVVMFVTYEQMKRAL MKVQMLRDSPF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | UCP3 |
Synonyms | UCP3; SLC25A9; Mitochondrial uncoupling protein 3; UCP 3; Solute carrier family 25 member 9 |
UniProt ID | O77792 |
◆ Recombinant Proteins | ||
RFL17290HF | Recombinant Full Length Human Mitochondrial Uncoupling Protein 3(Ucp3) Protein, His-Tagged | +Inquiry |
UCP3-5149H | Recombinant Human Uncoupling Protein 3 (mitochondrial, proton carrier) | +Inquiry |
UCP3-6079R | Recombinant Rat UCP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
UCP3-10676Z | Recombinant Zebrafish UCP3 | +Inquiry |
UCP3-5147H | Recombinant Human Uncoupling Protein 3 (mitochondrial, proton carrier) | +Inquiry |
◆ Cell & Tissue Lysates | ||
UCP3-524HCL | Recombinant Human UCP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UCP3 Products
Required fields are marked with *
My Review for All UCP3 Products
Required fields are marked with *