Recombinant Full Length Bovine Probable Palmitoyltransferase Zdhhc4(Zdhhc4) Protein, His-Tagged
Cat.No. : | RFL2390BF |
Product Overview : | Recombinant Full Length Bovine Probable palmitoyltransferase ZDHHC4(ZDHHC4) Protein (Q58DT3) (1-343aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-343) |
Form : | Lyophilized powder |
AA Sequence : | MDFLVLFLLYLALVLLGFVMICIGSKTHYLQGLISRGAQVFSYIIPECLQRAMLSVLHYL FHTRNYTFVVLHLILQGMVYTEYTWEIFGLCQQLEFSLYYLFLPYLLLIVNLLFFTLSCV TNPGTITKANELLFLQVYEFDGVMFPKNVRCPTCDLRKPARSKHCSVCNRCVHRFDHHCV WVNNCIGAWNTRYFLSYLFTLTASAATMAVVSTVFLVRLVVMSDVYLQTYVDDLGHLQVV DTVFLVQYLFLTFPRIVFLVGFVVVLSFLLGGYLCFCLYLAATNQTTNEWYKGDRAWCQH CPHVARPPAAEPQAYRNIHSHGLWSNLREIFLPATACYERKEK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ZDHHC4 |
Synonyms | ZDHHC4; Palmitoyltransferase ZDHHC4; Zinc finger DHHC domain-containing protein 4; DHHC-4 |
UniProt ID | Q58DT3 |
◆ Recombinant Proteins | ||
ZDHHC4-5095R | Recombinant Rhesus Macaque ZDHHC4 Protein, His (Fc)-Avi-tagged | +Inquiry |
ZDHHC4-316H | Recombinant Human ZDHHC4 Protein, MYC/DDK-tagged | +Inquiry |
Zdhhc4-7072M | Recombinant Mouse Zdhhc4 Protein, Myc/DDK-tagged | +Inquiry |
ZDHHC4-10404Z | Recombinant Zebrafish ZDHHC4 | +Inquiry |
RFL20511RF | Recombinant Full Length Rat Probable Palmitoyltransferase Zdhhc4(Zdhhc4) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZDHHC4-749HCL | Recombinant Human ZDHHC4 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZDHHC4 Products
Required fields are marked with *
My Review for All ZDHHC4 Products
Required fields are marked with *