Recombinant Full Length Bovine Receptor Expression-Enhancing Protein 4(Reep4) Protein, His-Tagged
Cat.No. : | RFL19410BF |
Product Overview : | Recombinant Full Length Bovine Receptor expression-enhancing protein 4(REEP4) Protein (Q3ZCI8) (1-257aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-257) |
Form : | Lyophilized powder |
AA Sequence : | MVSWMICRLVVLVFGMLYPAYASYKAVKTKNIREYVRWMMYWIVFALFMAVETFTDIFIS WFPFYYEIKMAFVLWLLSPYTRGASMLYRKFVHPSLSRHEKEIDTYIVQAKERSYETVLS FGKRGLNIAASAAVQAATKSQGALAGKLRSFSMQDLRTIPDGPAPTYQDPLYLEDQVPHR RPPIGYRAGGLRDSDTDNECWSDTEVVPQPPARPREKPLGRSQSLRVIKRKPLAREGTSR SLKVRTRKKTAPSDMDS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | REEP4 |
Synonyms | REEP4; Receptor expression-enhancing protein 4 |
UniProt ID | Q3ZCI8 |
◆ Recombinant Proteins | ||
REEP4-7516M | Recombinant Mouse REEP4 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL12826MF | Recombinant Full Length Mouse Receptor Expression-Enhancing Protein 4(Reep4) Protein, His-Tagged | +Inquiry |
REEP4-3659R | Recombinant Rhesus Macaque REEP4 Protein, His (Fc)-Avi-tagged | +Inquiry |
REEP4-14061M | Recombinant Mouse REEP4 Protein | +Inquiry |
REEP4-4643R | Recombinant Rat REEP4 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
REEP4-536HCL | Recombinant Human REEP4 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All REEP4 Products
Required fields are marked with *
My Review for All REEP4 Products
Required fields are marked with *