Recombinant Full Length Bovine Signal Peptidase Complex Subunit 1(Spcs1) Protein, His-Tagged
Cat.No. : | RFL8324BF |
Product Overview : | Recombinant Full Length Bovine Signal peptidase complex subunit 1(SPCS1) Protein (Q3T134) (1-102aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-102) |
Form : | Lyophilized powder |
AA Sequence : | MLEHLSSLPTQMDYKGQKLAEQMFQGIILFSAIVGFIYGYLAEQFGWTVYIVMAGFAFSC LLTLPPWPIYRRHPLKWLPVQDSSTEDKKPGERKVKRHAKNN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SPCS1 |
Synonyms | SPCS1; Signal peptidase complex subunit 1; Microsomal signal peptidase 12 kDa subunit; SPase 12 kDa subunit |
UniProt ID | Q3T134 |
◆ Recombinant Proteins | ||
RFL7341PF | Recombinant Full Length Pongo Abelii Signal Peptidase Complex Subunit 1(Spcs1) Protein, His-Tagged | +Inquiry |
RFL21401DF | Recombinant Full Length Dictyostelium Discoideum Signal Peptidase Complex Subunit 1(Spcs1) Protein, His-Tagged | +Inquiry |
SPCS1-15852M | Recombinant Mouse SPCS1 Protein | +Inquiry |
SPCS1-4005H | Recombinant Human SPCS1 protein, His-tagged | +Inquiry |
SPCS1-3388Z | Recombinant Zebrafish SPCS1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
SPCS1-1526HCL | Recombinant Human SPCS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SPCS1 Products
Required fields are marked with *
My Review for All SPCS1 Products
Required fields are marked with *
0
Inquiry Basket