Recombinant Full Length Bovine Solute Carrier Family 25 Member 34(Slc25A34) Protein, His-Tagged
| Cat.No. : | RFL32727BF |
| Product Overview : | Recombinant Full Length Bovine Solute carrier family 25 member 34(SLC25A34) Protein (Q3SZK0) (1-304aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Bovine |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-304) |
| Form : | Lyophilized powder |
| AA Sequence : | METVPPAVDLVLGASACCLACVFTNPLEVVKTRLQLQGELQKRGTYPRLYRGFVASVVAV VRADGLCGLQKGLAAGLLYQGLMNGVRFYCYSLACQAGLSQQPGGTVVAGAVAGALGAFV GSPAYLVKTQLQAQTVAAMAVGHQHHHESLLGALETIWRQQGLAGLWRGVGGAVPRVMVG SAAQLATFASAKAWVQERQWLPEDSWLVALAGGMISSIAVVAVMTPFDVVSTRLYNQPVD GAGRGKLYGGLTDCLVKIWRQEGPLALYKGLGPVYLRLGPHTILSMLFWDELRKLAGWGQ HQGS |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | SLC25A34 |
| Synonyms | SLC25A34; Solute carrier family 25 member 34 |
| UniProt ID | Q3SZK0 |
| ◆ Recombinant Proteins | ||
| SLC25A34-5475R | Recombinant Rat SLC25A34 Protein | +Inquiry |
| RFL7466MF | Recombinant Full Length Mouse Solute Carrier Family 25 Member 34(Slc25A34) Protein, His-Tagged | +Inquiry |
| SLC25A34-10858Z | Recombinant Zebrafish SLC25A34 | +Inquiry |
| SLC25A34-8285M | Recombinant Mouse SLC25A34 Protein, His (Fc)-Avi-tagged | +Inquiry |
| RFL2522DF | Recombinant Full Length Danio Rerio Solute Carrier Family 25 Member 34(Slc25A34) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SLC25A34-1766HCL | Recombinant Human SLC25A34 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC25A34 Products
Required fields are marked with *
My Review for All SLC25A34 Products
Required fields are marked with *
