Recombinant Full Length Bovine Vitamin K Epoxide Reductase Complex Subunit 1(Vkorc1) Protein, His-Tagged
Cat.No. : | RFL1890BF |
Product Overview : | Recombinant Full Length Bovine Vitamin K epoxide reductase complex subunit 1(VKORC1) Protein (Q6B4J2) (1-163aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-163) |
Form : | Lyophilized powder |
AA Sequence : | MGATWRSPGWVRLALCLAGLVLSLYALHVKAARARDRDYRALCDVGTAISCSRVFSSRWG RGFGLVEHVLGKDSILNQSNSIFGCIFYTLQLLLGCLQGRWASVLLRLSCLVSLAGSVYL AWILFFVLYDFCIVCITTYAINVGLTVLSFREVQGPQGKVKGH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | VKORC1 |
Synonyms | VKORC1; Vitamin K epoxide reductase complex subunit 1; Vitamin K1 2,3-epoxide reductase subunit 1 |
UniProt ID | Q6B4J2 |
◆ Recombinant Proteins | ||
VKORC1-0608H | Recombinant Human VKORC1 Protein (S3-E155), sfGFP, 10×His tagged | +Inquiry |
RFL1298MF | Recombinant Full Length Mouse Vitamin K Epoxide Reductase Complex Subunit 1(Vkorc1) Protein, His-Tagged | +Inquiry |
VKORC1-0609H | Recombinant Human VKORC1 Protein (M1-H163 end), sfGFP, 10×His tagged | +Inquiry |
VKORC1-7084C | Recombinant Chicken VKORC1 | +Inquiry |
VKORC1-10023M | Recombinant Mouse VKORC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
VKORC1-405HCL | Recombinant Human VKORC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VKORC1 Products
Required fields are marked with *
My Review for All VKORC1 Products
Required fields are marked with *