Recombinant Full Length Chicken Cell Cycle Control Protein 50A(Tmem30A) Protein, His-Tagged
| Cat.No. : | RFL7663GF |
| Product Overview : | Recombinant Full Length Chicken Cell cycle control protein 50A(TMEM30A) Protein (Q5F362) (1-372aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Chicken |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-372) |
| Form : | Lyophilized powder |
| AA Sequence : | MAVNYSAKEEADGHPAGGGPGGGATAGGGGAVKTRKPDNTAFKQQRLPAWQPILTAGTVL PAFFIIGLIFIPIGIGIFVTSNNIREYEIDYTGVEPSSPCNKCLNVSWDSTPPCTCTINF TLEHSFESNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDNSSLLNPSKECEPYRTNEDKPI APCGAIANSMFNDTLELYHIENDTRTAITLIKKGIAWWTDKNVKFRNPKGDGNLTALFQG TTKPVNWPKPVYMLDSEPDNNGFINEDFIVWMRTAALPTFRKLYRLIERKSNLQPTLQAG KYSLNITYNYPVHSFDGRKRMILSTISWMGGKNPFLGIAYITVGSICFFLGVVLLIIHHK YGNRNTSADIPN |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | TMEM30A |
| Synonyms | TMEM30A; CDC50A; RCJMB04_32j24; Cell cycle control protein 50A; P4-ATPase flippase complex beta subunit TMEM30A; Transmembrane protein 30A |
| UniProt ID | Q5F362 |
| ◆ Recombinant Proteins | ||
| RFL20210PF | Recombinant Full Length Pongo Abelii Cell Cycle Control Protein 50A(Tmem30A) Protein, His-Tagged | +Inquiry |
| TMEM30A-3823H | Recombinant Human TMEM30A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| TMEM30A-4633R | Recombinant Rhesus Macaque TMEM30A Protein, His (Fc)-Avi-tagged | +Inquiry |
| Tmem30a-6502M | Recombinant Mouse Tmem30a Protein, Myc/DDK-tagged | +Inquiry |
| TMEM30A-4819R | Recombinant Rhesus monkey TMEM30A Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TMEM30A-688HCL | Recombinant Human TMEM30A lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TMEM30A Products
Required fields are marked with *
My Review for All TMEM30A Products
Required fields are marked with *
