Recombinant Full Length Chicken Er Lumen Protein Retaining Receptor 2(Kdelr2) Protein, His-Tagged
| Cat.No. : | RFL10606GF |
| Product Overview : | Recombinant Full Length Chicken ER lumen protein retaining receptor 2(KDELR2) Protein (Q5ZKX9) (1-212aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Chicken |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-212) |
| Form : | Lyophilized powder |
| AA Sequence : | MNIFRLTGDLSHLAAIIILLLKIWKSRSCAGISGKSQLLFALVFTTRYLDLFTSFISLYN TSMKLIYIACSYATVYLIYMKFKATYDGNHDTFRVEFLIVPVGGLSFLVNHDFSPLEILW TFSIYLESVAILPQLFMISKTGEAETITTHYLFFLGLYRALYLVNWIWRYYFEGFFDLIA VVAGVVQTVLYCDFFYLYVTKVLKGKKLSLPA |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | KDELR2 |
| Synonyms | KDELR2; RCJMB04_8l23; ER lumen protein-retaining receptor 2; KDEL endoplasmic reticulum protein retention receptor 2; KDEL receptor 2 |
| UniProt ID | Q5ZKX9 |
| ◆ Recombinant Proteins | ||
| KDELR2-2379R | Recombinant Rhesus monkey KDELR2 Protein, His-tagged | +Inquiry |
| RFL10606GF | Recombinant Full Length Chicken Er Lumen Protein Retaining Receptor 2(Kdelr2) Protein, His-Tagged | +Inquiry |
| KDELR2-3950C | Recombinant Chicken KDELR2 | +Inquiry |
| RFL22749DF | Recombinant Full Length Danio Rerio Er Lumen Protein Retaining Receptor 2(Kdelr2) Protein, His-Tagged | +Inquiry |
| KDELR2-2891R | Recombinant Rat KDELR2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| KDELR2-5000HCL | Recombinant Human KDELR2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KDELR2 Products
Required fields are marked with *
My Review for All KDELR2 Products
Required fields are marked with *




