Recombinant Full Length Chicken Oligosaccharyltransferase Complex Subunit Ostc(Ostc) Protein, His-Tagged
Cat.No. : | RFL17582GF |
Product Overview : | Recombinant Full Length Chicken Oligosaccharyltransferase complex subunit OSTC(OSTC) Protein (Q5ZJR3) (1-149aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chicken |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-149) |
Form : | Lyophilized powder |
AA Sequence : | METLFRLPFAVLECPNIKLKRPGWVHMPSAMTVYALVVVSYFLITGGIIYDVIVEPPSVG SMTDEHGHQRPVAFLAYRVNGQYIMEGLASSFLFTMGGLGFIILDRSNAPNIPKLNRFLL LFIGFVSVLLSFFMARVFMRMKLPGYLMG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | OSTC |
Synonyms | OSTC; RCJMB04_16e19; Oligosaccharyltransferase complex subunit OSTC |
UniProt ID | Q5ZJR3 |
◆ Recombinant Proteins | ||
OSTC-26H | Recombinant Human OSTC Protein, GST-tagged | +Inquiry |
RFL17896MF | Recombinant Full Length Mouse Oligosaccharyltransferase Complex Subunit Ostc(Ostc) Protein, His-Tagged | +Inquiry |
RFL22379RF | Recombinant Full Length Rat Oligosaccharyltransferase Complex Subunit Ostc(Ostc) Protein, His-Tagged | +Inquiry |
OSTC-4212R | Recombinant Rat OSTC Protein | +Inquiry |
OSTC-1582C | Recombinant Chicken OSTC | +Inquiry |
◆ Cell & Tissue Lysates | ||
OSTC-3522HCL | Recombinant Human OSTC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All OSTC Products
Required fields are marked with *
My Review for All OSTC Products
Required fields are marked with *