Recombinant Full Length Chlorocebus Aethiops Cytochrome B-C1 Complex Subunit Rieske, Mitochondrial(Uqcrfs1) Protein, His-Tagged
| Cat.No. : | RFL23592CF |
| Product Overview : | Recombinant Full Length Chlorocebus aethiops Cytochrome b-c1 complex subunit Rieske, mitochondrial(UQCRFS1) Protein (Q69BK1) (79-274aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Chlorocebus Aethiops |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length of Mature Protein (79-274) |
| Form : | Lyophilized powder |
| AA Sequence : | SHTDVKVPDFYDYRRLEVLDSTKSSRESSEARKGFSYLVTAVTTVGVAYAAKNVVTQFIS SMSASADVLAMAKIEINLSDIPEGKNMAFKWRGKPLFVRHRTQKEIEEEAAVELSQLRDP QHDLDRVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRLGPAPLNL EVPPYEFTGDDVVVVG |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | UQCRFS1 |
| Synonyms | UQCRFS1; Cytochrome b-c1 complex subunit Rieske, mitochondrial; Complex III subunit 5; Cytochrome b-c1 complex subunit 5; Rieske iron-sulfur protein; RISP; Rieske protein UQCRFS1; Ubiquinol-cytochrome c reductase iron-sulfur subunit |
| UniProt ID | Q69BK1 |
| ◆ Recombinant Proteins | ||
| RFL34847LF | Recombinant Full Length Lagothrix Lagotricha Cytochrome B-C1 Complex Subunit Rieske, Mitochondrial(Uqcrfs1) Protein, His-Tagged | +Inquiry |
| UQCRFS1-5973Z | Recombinant Zebrafish UQCRFS1 | +Inquiry |
| UQCRFS1-569HF | Recombinant Full Length Human UQCRFS1 Protein, GST-tagged | +Inquiry |
| UQCRFS1-6459R | Recombinant Rat UQCRFS1 Protein | +Inquiry |
| UQCRFS1-1278C | Recombinant Chicken UQCRFS1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| UQCRFS1-725HCL | Recombinant Human UQCRFS1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UQCRFS1 Products
Required fields are marked with *
My Review for All UQCRFS1 Products
Required fields are marked with *
