Recombinant Full Length Cricetulus Griseus P2Y Purinoceptor 4(P2Ry4) Protein, His-Tagged
Cat.No. : | RFL17947CF |
Product Overview : | Recombinant Full Length Cricetulus griseus P2Y purinoceptor 4(P2RY4) Protein (P58826) (1-165aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Cricetulus griseus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-165) |
Form : | Lyophilized powder |
AA Sequence : | SDTLYVLSLPTLVYYYAARNHWPFGTGFCKFVRFLFYWNLYCSVLFLTCISVHRYMGICH PLRALRWGRPRFASLLCLAVWLVVAGCLVPNLFFVTTSPNGTTILCHDTTRPEEFDHYVH FSSAVMVLLFGLPFLVTLVCYGLMARRLYRPLPGAGQSSSRLRSL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | P2RY4 |
Synonyms | P2RY4; P2Y purinoceptor 4; P2Y4; P2Y4 metabotropic purinergic receptor; Fragment |
UniProt ID | P58826 |
◆ Recombinant Proteins | ||
P2RY4-4238R | Recombinant Rat P2RY4 Protein | +Inquiry |
RFL14157MF | Recombinant Full Length Mouse P2Y Purinoceptor 4(P2Ry4) Protein, His-Tagged | +Inquiry |
P2RY4-3091R | Recombinant Rhesus Macaque P2RY4 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL17947CF | Recombinant Full Length Cricetulus Griseus P2Y Purinoceptor 4(P2Ry4) Protein, His-Tagged | +Inquiry |
P2RY4-1499H | Recombinant Human P2RY4, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
P2RY4-465HCL | Recombinant Human P2RY4 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All P2RY4 Products
Required fields are marked with *
My Review for All P2RY4 Products
Required fields are marked with *
0
Inquiry Basket