Recombinant Full Length Cricetulus Griseus Vesicle-Trafficking Protein Sec22B(Sec22B) Protein, His-Tagged
Cat.No. : | RFL23377CF |
Product Overview : | Recombinant Full Length Cricetulus griseus Vesicle-trafficking protein SEC22b(Sec22b) Protein (O08595) (2-215aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Cricetulus griseus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (2-215) |
Form : | Lyophilized powder |
AA Sequence : | VLLTMIARVADGLPLAASMQEDEQSGRDLQQYQSQAKQLFRKLNEQSPTRCTLGAGAMTFHYIIEQGVCYLVLCEAAFPKKLAFAYLEDLHSEFDEQHGKKVPTVSRPYSFIEFDTFIQKTKKLYIDSRARRNLGSINTELQDVQRIMVANIEEVLQRGEALSALDSKANNLSSLSKKYRQDAKYLNMRSTYAKLAAVAVFFIMLIVYVRFWWL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Sec22b |
Synonyms | Sec22b; Ers-24; Vesicle-trafficking protein SEC22b; ER-Golgi SNARE of 24 kDa; ERS-24; ERS24; SEC22 vesicle-trafficking protein homolog B |
UniProt ID | O08595 |
◆ Recombinant Proteins | ||
RFL27265MF | Recombinant Full Length Mouse Vesicle-Trafficking Protein Sec22B(Sec22B) Protein, His-Tagged | +Inquiry |
SEC22B-5301R | Recombinant Rat SEC22B Protein | +Inquiry |
SEC22B-2924C | Recombinant Chicken SEC22B | +Inquiry |
SEC22B-4960R | Recombinant Rat SEC22B Protein, His (Fc)-Avi-tagged | +Inquiry |
SEC22B-7984M | Recombinant Mouse SEC22B Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SEC22B-580HCL | Recombinant Human SEC22B lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Sec22b Products
Required fields are marked with *
My Review for All Sec22b Products
Required fields are marked with *