Recombinant Full Length Danio Rerio Adenosine Monophosphate-Protein Transferase Ficd(Ficd) Protein, His-Tagged
Cat.No. : | RFL8871DF |
Product Overview : | Recombinant Full Length Danio rerio Adenosine monophosphate-protein transferase FICD(ficd) Protein (Q6ZM51) (1-449aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | zebrafish |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-449) |
Form : | Lyophilized powder |
AA Sequence : | MAALAVLRYAGSSPLLWGWGPILFGLLGSVFVLLLPLVGIEEQCCATLKGLALLRCQMWG GIQRPVVHTTSLAVPFTALDLLPQKVKPSKETQLEAKAALQQALEMKKSGKREKAHKLLV HALNMNPEFVEALTELGTILEEEKDVVQADHLYTKALAISPCHEKALVSRDRTLPLVEEI DQRHFGIIDGKVRRLMSIPKGNSALRRVMEETYYHHIYHTVAIEGNTLTLSEIRHIIETR YAVPGKSLQEQNEAIGVDVAMKYINTTLLSRDGAITVNDILEIHRRVLGYADPVEAGRFR VNQVFVGHHIPPHPQDLDKHMQELVQWLNSEETLHLHPVEFAALAHYKLVYVHPFVDGNG RTSRLLMNLILMQASYPPITIRKEQRAEYYAALDTANEGDVRPFIRFIAKCTEMTLDTLL IATTEHAVGLPGASNHACPDCKQTIPVHS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ficd |
Synonyms | ficd; si:ch211-191d15.5; zgc:110336; Protein adenylyltransferase FICD; AMPylator FICD; FIC domain-containing protein |
UniProt ID | Q6ZM51 |
◆ Recombinant Proteins | ||
FICD-3257M | Recombinant Mouse FICD Protein, His (Fc)-Avi-tagged | +Inquiry |
FICD-2348R | Recombinant Rat FICD Protein | +Inquiry |
FICD-1658H | Recombinant Human FICD Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RFL8871DF | Recombinant Full Length Danio Rerio Adenosine Monophosphate-Protein Transferase Ficd(Ficd) Protein, His-Tagged | +Inquiry |
FICD-2530Z | Recombinant Zebrafish FICD | +Inquiry |
◆ Cell & Tissue Lysates | ||
FICD-6219HCL | Recombinant Human FICD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ficd Products
Required fields are marked with *
My Review for All ficd Products
Required fields are marked with *
0
Inquiry Basket