Recombinant Full Length Danio Rerio Alkaline Ceramidase 1(Acer1) Protein, His-Tagged
| Cat.No. : | RFL-1430DF |
| Product Overview : | Recombinant Full Length Danio rerio Alkaline ceramidase 1(acer1) Protein (Q568I2) (1-266aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | zebrafish |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-266) |
| Form : | Lyophilized powder |
| AA Sequence : | MAGVFSYESSEVDWCEDNYKHSENVVEYFNTMSSFIFFVISPIMLYLLHPYAKERNLAVH LVWIMMVFVGIFSMYFHMTLSFMGQMLDELSILWVLAIGYSLWFPRKHFPSFVKDRTSFA RLVLTITIISTLSSFVKPTANAYALNCFAIHILYSLFVELKSCTDERVLRLAWASIGLWV LAISCWISDRFGCSFWQKLDFCYLHGIWHILIVMATAYASTLIAYLDASQEIPYSLPDLQ YWPRNNWAIGLPYIVLKGTNTTRKTC |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | acer1 |
| Synonyms | acer1; asah3; zgc:110285; Alkaline ceramidase 1; AlkCDase 1; Alkaline CDase 1; Acylsphingosine deacylase 3; N-acylsphingosine amidohydrolase 3 |
| UniProt ID | Q568I2 |
| ◆ Recombinant Proteins | ||
| ACER1-254H | Recombinant Human ACER1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| RFL-18290HF | Recombinant Full Length Human Alkaline Ceramidase 1(Acer1) Protein, His-Tagged | +Inquiry |
| ACER1-1828HFL | Recombinant Full Length Human ACER1 Protein, C-Flag-tagged | +Inquiry |
| ACER1-2376Z | Recombinant Zebrafish ACER1 | +Inquiry |
| ACER1-1185M | Recombinant Mouse ACER1 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ACER1-9093HCL | Recombinant Human ACER1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All acer1 Products
Required fields are marked with *
My Review for All acer1 Products
Required fields are marked with *



