Recombinant Full Length Danio Rerio Insulin-Induced Gene 1 Protein(Insig1) Protein, His-Tagged
Cat.No. : | RFL19353DF |
Product Overview : | Recombinant Full Length Danio rerio Insulin-induced gene 1 protein(insig1) Protein (Q8AV61) (1-251aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | zebrafish |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-251) |
Form : | Lyophilized powder |
AA Sequence : | MPRLEEHCWSCSCSTSVKTKDLSSAGWIVCKTGEMMSIITSVLSHAYGSLHSLQSANLIR RGLVLFIVGVVLALVLNLLQIQRNVTLFPEEVLDTLFSSAWWIPLCCGTAAAVVGLLYPC LDHHLGEPHKFKREWASVMRCIAVFVGINHASAKLDFANNVQLSLTLAALSLGLWWTFDR SRSGFGLGLTTALLATLIAQLLVYNGIYQYTSPDFLYVRSWLPCIFFSGGVTVGNIGRQL AMGSTEKIHND |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | insig1 |
Synonyms | insig1; Insulin-induced gene 1 protein; INSIG-1 |
UniProt ID | Q8AV61 |
◆ Recombinant Proteins | ||
INSIG1-10242Z | Recombinant Zebrafish INSIG1 | +Inquiry |
INSIG1-624C | Recombinant Cynomolgus INSIG1 Protein, His-tagged | +Inquiry |
RFL18028GF | Recombinant Full Length Chicken Insulin-Induced Gene 1 Protein(Insig1) Protein, His-Tagged | +Inquiry |
INSIG1-4562M | Recombinant Mouse INSIG1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL27359XF | Recombinant Full Length Xenopus Tropicalis Insulin-Induced Gene 1 Protein(Insig1) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
INSIG1-5194HCL | Recombinant Human INSIG1 293 Cell Lysate | +Inquiry |
INSIG1-5193HCL | Recombinant Human INSIG1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All insig1 Products
Required fields are marked with *
My Review for All insig1 Products
Required fields are marked with *