Recombinant Full Length Danio Rerio Leucine-Rich Repeat, Immunoglobulin-Like Domain And Transmembrane Domain-Containing Protein 2(Lrit2) Protein, His-Tagged
Cat.No. : | RFL32967DF |
Product Overview : | Recombinant Full Length Danio rerio Leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 2(lrit2) Protein (Q504C1) (22-561aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | zebrafish |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (22-561) |
Form : | Lyophilized powder |
AA Sequence : | ECFPGCSCGTDRHGRSLTCMETALTGIPDGLPEDLTKIRIEKSQLSELPEAVFSHVKALK HLWLNFNDIAIINIKSLEGLANLTELRLQGNKLRSVPWTAFEETPNLKILDLKHNRIDAL PEHALKFLPGLTYLDLSSNQLSVISKDVFLNWPLYHSENKHEKPSASNVVLALHDNPWLC DCRLGGFIEFIKSLTPPFILMNSYLTCSSPELKAGRFFHEVDLKTCVKPVVSAPVITITA PLGGNVTLTCSASARPEAVIRWIYALKMLRGFRDILSHVDEDTISSQLVIPSLHSADRGL YTCIANNFLGNSSVIISVDVKSPEGSSSHPSGPSAAIGEENVYIDIRIAKQTVYGITIEW RAVTENPAETWFTIHFGRYDAVKKEQIYIGPGINTYSVTDLLPATKYEICVTLKNQAPRI GQCIVFVTGSDFNEMEQREKLIHIVVIVLAMVLAVPAGMYACTTDAKFNCFERCAELWRN RRHAELSNPTGDRQGTFDSLQAASDEGLYKESNKDKKARRRSAEKIHKTKNDRRPTAELY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | lrit2 |
Synonyms | lrit2; zgc:109962; Leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 2 |
UniProt ID | Q504C1 |
◆ Recombinant Proteins | ||
RFL32967DF | Recombinant Full Length Danio Rerio Leucine-Rich Repeat, Immunoglobulin-Like Domain And Transmembrane Domain-Containing Protein 2(Lrit2) Protein, His-Tagged | +Inquiry |
LRIT2-150H | Active Recombinant Human LRIT2, His-tagged | +Inquiry |
LRIT2-2729Z | Recombinant Zebrafish LRIT2 | +Inquiry |
LRIT2-1616H | Recombinant Human LRIT2 | +Inquiry |
LRIT2-2962H | Recombinant Human LRIT2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All lrit2 Products
Required fields are marked with *
My Review for All lrit2 Products
Required fields are marked with *
0
Inquiry Basket