Recombinant Full Length Danio Rerio Mitochondrial Inner Membrane Protease Subunit 2(Immp2L) Protein, His-Tagged
| Cat.No. : | RFL18491DF |
| Product Overview : | Recombinant Full Length Danio rerio Mitochondrial inner membrane protease subunit 2(immp2l) Protein (Q6AZD4) (1-183aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | zebrafish |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-183) |
| Form : | Lyophilized powder |
| AA Sequence : | MAQTGFGRRYFKAFVSGFFVAVPVTVTVLDRLAYVARVEGASMQPSLNPDGESSPDVVLL NRWSVRNYHVQRGDIVSVLSPKNPQQKIIKRVIGIEGDFIKTLGYKNRYVRVPDGHLWIE GDHHGHSFDSNAFGPVSLGLVHGRASHIIWPPSRWQRIEPSVPPDRRPLLNWDRAAEDKY DDD |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | immp2l |
| Synonyms | immp2l; zgc:100888; Mitochondrial inner membrane protease subunit 2; IMP2-like protein |
| UniProt ID | Q6AZD4 |
| ◆ Recombinant Proteins | ||
| IMMP2L-4529M | Recombinant Mouse IMMP2L Protein, His (Fc)-Avi-tagged | +Inquiry |
| IMMP2L-8191M | Recombinant Mouse IMMP2L Protein | +Inquiry |
| RFL2622XF | Recombinant Full Length Xenopus Laevis Mitochondrial Inner Membrane Protease Subunit 2(Immp2L) Protein, His-Tagged | +Inquiry |
| IMMP2L-4773C | Recombinant Chicken IMMP2L | +Inquiry |
| IMMP2L-2261R | Recombinant Rhesus monkey IMMP2L Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All immp2l Products
Required fields are marked with *
My Review for All immp2l Products
Required fields are marked with *


