Recombinant Full Length Danio Rerio Mitochondrial Uncoupling Protein 2(Ucp2) Protein, His-Tagged
Cat.No. : | RFL26536DF |
Product Overview : | Recombinant Full Length Danio rerio Mitochondrial uncoupling protein 2(ucp2) Protein (Q9W720) (1-310aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | zebrafish |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-310) |
Form : | Lyophilized powder |
AA Sequence : | MVGFRAGDVPPTATVKFIGAGTAACIADLFTFPLDTAKVRLQIQGENKASTNMGRGPVKY RGVFGTISTMVRVEGPRSLYSGLVAGLQRQMSFASVRIGLYDSVKQFYTKGSDHAGIGSR LMAGCTTGAMAVAVAQPTDVLKVRFQAQVSAGASKRYHSTMDAYRTIAKEEGFRGLWKGT GPNITRNAIVNCTELVTYDLIKDALLKSSLMTDDLPCHFTSAFGAGFCTTIIASPVDVVK TRYMNSAQGQYSSALNCAVAMLTKKGPKAFFKGFMPSFLRLGSWNVVMFVTYEQLKRAMM AARQNWHTPL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ucp2 |
Synonyms | ucp2; slc25a8; Mitochondrial uncoupling protein 2; UCP 2; Solute carrier family 25 member 8 |
UniProt ID | Q9W720 |
◆ Recombinant Proteins | ||
UCP2-9873M | Recombinant Mouse UCP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL33880RF | Recombinant Full Length Rat Mitochondrial Uncoupling Protein 2(Ucp2) Protein, His-Tagged | +Inquiry |
UCP2-17790M | Recombinant Mouse UCP2 Protein | +Inquiry |
Ucp2-7917M | Recombinant Mouse Ucp2 protein, His-tagged | +Inquiry |
UCP2-5091R | Recombinant Rhesus monkey UCP2 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
UCP2-525HCL | Recombinant Human UCP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ucp2 Products
Required fields are marked with *
My Review for All ucp2 Products
Required fields are marked with *