Recombinant Full Length Danio Rerio N-Acetylaspartate Synthetase(Nat8L) Protein, His-Tagged
Cat.No. : | RFL25461DF |
Product Overview : | Recombinant Full Length Danio rerio N-acetylaspartate synthetase(nat8l) Protein (A4IGD2) (1-282aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | zebrafish |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-282) |
Form : | Lyophilized powder |
AA Sequence : | MHCSSPKMVCETKIVADEHEAIAGTKKDSIIVSSSQMWTSSSASPSALESKIEKRNQVFI REFERSDHEEVRRIFNEGIMERIPNSAFRGLKQQTTTQFMYAFLTVMCYVMTKSFTLTFC APFILMGARYYYSRKVILSYLDCALHTDMADIEAYYMKPTGSCFWVAVLQGQVVGIVAAQ SREDDNTVELRRMSVDSHFRGKGIAKALGRRVIEFAMLNNYSAVVLGTTAVKMAAHKLYE SLGFRRVGETEDYTLPGMTRSPLERLFFQIRYSHYRLQLHEE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | nat8l |
Synonyms | nat8l; zgc:162648; N-acetylaspartate synthetase; NAA synthetase; N-acetyltransferase 8-like protein |
UniProt ID | A4IGD2 |
◆ Recombinant Proteins | ||
NAT8L-3910R | Recombinant Rat NAT8L Protein | +Inquiry |
NAT8L-3569R | Recombinant Rat NAT8L Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL25461DF | Recombinant Full Length Danio Rerio N-Acetylaspartate Synthetase(Nat8L) Protein, His-Tagged | +Inquiry |
RFL3493MF | Recombinant Full Length Mouse N-Acetylaspartate Synthetase(Nat8L) Protein, His-Tagged | +Inquiry |
NAT8L-4994H | Recombinant Human NAT8L protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NAT8L-3960HCL | Recombinant Human NAT8L 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All nat8l Products
Required fields are marked with *
My Review for All nat8l Products
Required fields are marked with *