Recombinant Full Length Danio Rerio Nuclear Envelope Phosphatase-Regulatory Subunit 1(Cnep1R1) Protein, His-Tagged
Cat.No. : | RFL8112DF |
Product Overview : | Recombinant Full Length Danio rerio Nuclear envelope phosphatase-regulatory subunit 1(cnep1r1) Protein (Q561X0) (1-125aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | zebrafish |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-125) |
Form : | Lyophilized powder |
AA Sequence : | MNSLEQAEDLKAFERRLTEYVSCLQPATGRWRMILIVVSVCTATGAWNWLIDPDTQKVSF FSSLWNHPFFTISCVTLIGLFFAGIHKRVVAPSIIAARCRTVLAEYNMSCDDTGKLILKP RPHIQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | cnep1r1 |
Synonyms | cnep1r1; tmem188; zgc:110674; Nuclear envelope phosphatase-regulatory subunit 1; Transmembrane protein 188 |
UniProt ID | Q561X0 |
◆ Recombinant Proteins | ||
Cnep1r1-2216M | Recombinant Mouse Cnep1r1 Protein, Myc/DDK-tagged | +Inquiry |
RFL8112DF | Recombinant Full Length Danio Rerio Nuclear Envelope Phosphatase-Regulatory Subunit 1(Cnep1R1) Protein, His-Tagged | +Inquiry |
CNEP1R1-4226C | Recombinant Chicken CNEP1R1 | +Inquiry |
CNEP1R1-2595Z | Recombinant Zebrafish CNEP1R1 | +Inquiry |
RFL25678MF | Recombinant Full Length Mouse Nuclear Envelope Phosphatase-Regulatory Subunit 1(Cnep1R1) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CNEP1R1-978HCL | Recombinant Human TMEM188 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All cnep1r1 Products
Required fields are marked with *
My Review for All cnep1r1 Products
Required fields are marked with *
0
Inquiry Basket