Recombinant Full Length Danio Rerio Orm1-Like Protein 3(Ormdl3) Protein, His-Tagged
Cat.No. : | RFL29382DF |
Product Overview : | Recombinant Full Length Danio rerio ORM1-like protein 3(ormdl3) Protein (Q5XJR6) (1-153aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | zebrafish |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-153) |
Form : | Lyophilized powder |
AA Sequence : | MNVGTAHSEVNPNTRVMNSRGIWLSYVLGIGLLHIILLSIPFVSVPVVWTLTNLIHNMCM YIFLHTVKGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIILYFLTSFYTKYD RVHFVINTISLLTVLIPKLPQFHGVRLFGINKY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ormdl3 |
Synonyms | ormdl3; zgc:101654; ORM1-like protein 3 |
UniProt ID | Q5XJR6 |
◆ Recombinant Proteins | ||
ORMDL3-3248R | Recombinant Rhesus monkey ORMDL3 Protein, His-tagged | +Inquiry |
ORMDL3-185H | Recombinant Human ORMDL3 Protein, GST-tagged | +Inquiry |
RFL8065AF | Recombinant Full Length Ailuropoda Melanoleuca Orm1-Like Protein 3(Ormdl3) Protein, His-Tagged | +Inquiry |
ORMDL3-4203R | Recombinant Rat ORMDL3 Protein | +Inquiry |
ORMDL3-3066R | Recombinant Rhesus Macaque ORMDL3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ORMDL3-3546HCL | Recombinant Human ORMDL3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ormdl3 Products
Required fields are marked with *
My Review for All ormdl3 Products
Required fields are marked with *