Recombinant Full Length Danio Rerio Sodium/Potassium-Transporting Atpase Subunit Beta-1-Interacting Protein 1(Nkain1) Protein, His-Tagged
Cat.No. : | RFL32345DF |
Product Overview : | Recombinant Full Length Danio rerio Sodium/potassium-transporting ATPase subunit beta-1-interacting protein 1(nkain1) Protein (Q6PHL4) (1-207aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | zebrafish |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-207) |
Form : | Lyophilized powder |
AA Sequence : | MGRCDGRCTLVVICCLQLVAALQRQVFDFMGYQWAPILANFLHIMAVILGVFGTVQVRSR YLILYAVWLVVWVGWNSFIICFYLEVGHLSQDRDFLMTFNTSLHRSWWMENGPGCLVTPV PDSPLAPQDHHVITVSGCLLDYQYIEVVSSALQVFLALFGFVYACYVSKYSPDDEDSFDF FDGLGSYNYQPPQKISQLQLRPLYTTG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | nkain1 |
Synonyms | nkain1; zgc:65908; Sodium/potassium-transporting ATPase subunit beta-1-interacting protein 1; Na(+/K(+-transporting ATPase subunit beta-1-interacting protein 1 |
UniProt ID | Q6PHL4 |
◆ Recombinant Proteins | ||
NKAIN1-8896H | Recombinant Human NKAIN1 protein, His-tagged | +Inquiry |
NKAIN1-10683M | Recombinant Mouse NKAIN1 Protein | +Inquiry |
NKAIN1-6079M | Recombinant Mouse NKAIN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL10369XF | Recombinant Full Length Xenopus Tropicalis Sodium/Potassium-Transporting Atpase Subunit Beta-1-Interacting Protein 1(Nkain1) Protein, His-Tagged | +Inquiry |
NKAIN1-5884H | Recombinant Human NKAIN1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NKAIN1-3822HCL | Recombinant Human NKAIN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All nkain1 Products
Required fields are marked with *
My Review for All nkain1 Products
Required fields are marked with *
0
Inquiry Basket