Recombinant Full Length Danio Rerio Tm2 Domain-Containing Protein 2(Tm2D2) Protein, His-Tagged
| Cat.No. : | RFL7223DF |
| Product Overview : | Recombinant Full Length Danio rerio TM2 domain-containing protein 2(tm2d2) Protein (Q6DHN3) (33-229aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | zebrafish |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length of Mature Protein (33-229) |
| Form : | Lyophilized powder |
| AA Sequence : | QNSTEPPGNRVTTSKPVLFSEQPEENVTESGSVIPTETSNHTEQYEYNPPSPVVLCRYLP EEFIFCQDPVDHGGNVSAFQELGYGCVKFGGQVYKDVNHTQVLCTALDGIECAGPREFLR GNEPCIKYTGHYFITTLLYSFFLGCFGVDRFCLGHTGTAVGKLLTLGGLGIWWFVDLILL ITGGLTPSDSSNWCTFY |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | tm2d2 |
| Synonyms | tm2d2; si:dkey-49o11.3; zgc:92201; TM2 domain-containing protein 2 |
| UniProt ID | Q6DHN3 |
| ◆ Recombinant Proteins | ||
| RFL24276BF | Recombinant Full Length Bovine Tm2 Domain-Containing Protein 2(Tm2D2) Protein, His-Tagged | +Inquiry |
| RFL31889HF | Recombinant Full Length Human Tm2 Domain-Containing Protein 2(Tm2D2) Protein, His-Tagged | +Inquiry |
| TM2D2-4553R | Recombinant Rhesus Macaque TM2D2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| TM2D2-16836M | Recombinant Mouse TM2D2 Protein | +Inquiry |
| TM2D2-9243M | Recombinant Mouse TM2D2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TM2D2-1038HCL | Recombinant Human TM2D2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All tm2d2 Products
Required fields are marked with *
My Review for All tm2d2 Products
Required fields are marked with *
