Recombinant Full Length Danio Rerio Tm2 Domain-Containing Protein 3(Tm2D3) Protein, His-Tagged
Cat.No. : | RFL8975DF |
Product Overview : | Recombinant Full Length Danio rerio TM2 domain-containing protein 3(tm2d3) Protein (A5PLF5) (22-244aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | zebrafish |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (22-244) |
Form : | Lyophilized powder |
AA Sequence : | YLSSPHVGQDPPYLAQQKSVMSSPVALTASSASPVVTDNYVSKCPSGGLCSKLPADCIIC ALHHNCSYGRPHNYTCRPRAGVHCVSDQGERQQNFTLSLLCRFCFQLDASQYRCSNSSDC MTVSCPRRRYNASCEVLEHVHCLGKRVFQKRLFCNWTGGYKWSTALALSITLGGFGADRF YLGQWREGLGKLFSFGGLGIWTLIDVLLIGVGYVGPADGSLYI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | tm2d3 |
Synonyms | tm2d3; zgc:165591; TM2 domain-containing protein 3 |
UniProt ID | A5PLF5 |
◆ Recombinant Proteins | ||
RFL31847HF | Recombinant Full Length Human Tm2 Domain-Containing Protein 3(Tm2D3) Protein, His-Tagged | +Inquiry |
TM2D3-5759Z | Recombinant Zebrafish TM2D3 | +Inquiry |
RFL12165XF | Recombinant Full Length Xenopus Laevis Tm2 Domain-Containing Protein 3(Tm2D3) Protein, His-Tagged | +Inquiry |
TM2D3-430H | Recombinant Human TM2D3 Protein, His-tagged | +Inquiry |
TM2D3-5555C | Recombinant Chicken TM2D3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
TM2D3-1037HCL | Recombinant Human TM2D3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All tm2d3 Products
Required fields are marked with *
My Review for All tm2d3 Products
Required fields are marked with *