Recombinant Full Length Danio Rerio Zinc Transporter Slc39A7(Slc39A7) Protein, His-Tagged
| Cat.No. : | RFL21257DF |
| Product Overview : | Recombinant Full Length Danio rerio Zinc transporter Slc39a7(slc39a7) Protein (Q9PUB8) (1-352aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | zebrafish |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-352) |
| Form : | Lyophilized powder |
| AA Sequence : | MRVFSKSLLLIAVGILMSQQTLAHSHHHHGHGDGGCHGHSHGGAKMHHGASKWSAEANLP HAEEEHHVHDHGHTHDHAHDHGHAHSHGDIHDHGHAHKHGHAHDHGAEKSKKVVEAGKRN MVELWMQAIGATLLISAAPFLILFLIPVQSNTDQHQNLLKVLLSFASGGLLGDAFLHLIP HALEPHSHHSQPHSEESHGQSHGEESHGHSHGAAHGHMMSVGLWVLGGIVAFLVVEKFVR LLKGGHSHSHSHSPSAPKSKDSDEEDDKKGQKKGEKDKVVSQQKPTKKTVETSSDIKVSG YLNLAADFTHNFTDGLAIGASFLVGPAVGAVTTITILLHEVPHEIGDFAILV |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | slc39a7 |
| Synonyms | slc39a7; hke4; ke4; Zinc transporter Slc39a7; Histidine-rich membrane protein Ke4; Solute carrier family 39 member 7; Zrt-, Irt-like protein 7; ZIP7; Fragment |
| UniProt ID | Q9PUB8 |
| ◆ Recombinant Proteins | ||
| SLC39A7-657H | Recombinant Human SLC39A7 Protein (1-469 aa), GST-tagged | +Inquiry |
| RFL19911SF | Recombinant Full Length Pig Zinc Transporter Slc39A7(Slc39A7) Protein, His-Tagged | +Inquiry |
| SLC39A7-4107R | Recombinant Rhesus Macaque SLC39A7 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SLC39A7-15440M | Recombinant Mouse SLC39A7 Protein | +Inquiry |
| SLC39A7-4291R | Recombinant Rhesus monkey SLC39A7 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SLC39A7-1717HCL | Recombinant Human SLC39A7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All slc39a7 Products
Required fields are marked with *
My Review for All slc39a7 Products
Required fields are marked with *
