Recombinant Full Length Dictyostelium Discoideum Frizzled/Smoothened-Like Sans Crd Protein B(Fscb) Protein, His-Tagged
Cat.No. : | RFL30060DF |
Product Overview : | Recombinant Full Length Dictyostelium discoideum Frizzled/smoothened-like sans CRD protein B(fscB) Protein (Q54RQ3) (23-436aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dictyostelium Discoideum |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (23-436) |
Form : | Lyophilized powder |
AA Sequence : | QKLPDGFCPSPLIYKNSTDRISDINRGYQFIGETNCVQPCPSLVYSESDWKNFFDASLYG GAISIFCSLFLLITYSPLVNNKHNRHTISIMFLFSGIFIMLASNGRVFWNNNEGYFDRIC PEKGRFARQSDRYCLAMGIFYQFGCLTGMMWWTTLSVDVWMTIKKIKISNRQIFYYACIV NFLAIFLTFIPIARDQYGASNFGIGCWILGLWDQVFGFWAPLGICLTIGCIFITLIMYEI YKATGQIKKKLLLKYYKPLVLIILMFFEFFYMFIFITYIIDHRNKYNDEVAEYIVCILIN SGNPNYDEICKIKRSIPPAAQFLFFLFSRLMGFEGVIFYGLTNQTKRIWLRSFWFNNRIS LKFRSSFNISSSTNSSTNTFEKQTPSHLVDPIDQFDNIEISNNQNIELSQIENK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | fscB |
Synonyms | fscB; DDB_G0282989; Frizzled/smoothened-like sans CRD protein B |
UniProt ID | Q54RQ3 |
◆ Recombinant Proteins | ||
FSCB-2051R | Recombinant Rat FSCB Protein, His (Fc)-Avi-tagged | +Inquiry |
FSCB-2395R | Recombinant Rat FSCB Protein | +Inquiry |
FSCB-13011H | Recombinant Human FSCB, GST-tagged | +Inquiry |
FSCB-4510H | Recombinant Human FSCB Protein, GST-tagged | +Inquiry |
FSCB-5073HF | Recombinant Full Length Human FSCB Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FSCB-205HCL | Recombinant Human FSCB cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All fscB Products
Required fields are marked with *
My Review for All fscB Products
Required fields are marked with *
0
Inquiry Basket