Recombinant Full Length Dictyostelium Discoideum Putative Lysophosphatidylcholine Acyltransferase(Taz) Protein, His-Tagged
Cat.No. : | RFL2542DF |
Product Overview : | Recombinant Full Length Dictyostelium discoideum Putative lysophosphatidylcholine acyltransferase(taz) Protein (Q54DX7) (1-285aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dictyostelium Discoideum |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-285) |
Form : | Lyophilized powder |
AA Sequence : | MDSNNSNNNNKNLKQICDIPKPQFLSKGVFTLVGVLCKFWISMNTVTTSGIDKLVNEIDK THQLKRPMITIANHSSNLDDPLLWGVLPNRILMDPSKQRWTLGASNILFTNWFYSKFFSL GKCIKIVRGDGIYQDGMNESIDRLSEGQWLHIFPEGRISQQTQLLYFKWGLGRLVGECYR RTGVVPLVVPIYHQGMEKSMPLAKLPIPRVGINLDIKVGDNIYCDQVISKYIDDNKISDL TDYLSQDDKKRKDFYKTITLHIEDEYQKIIPPTNRGRFSHPTIKD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | taz |
Synonyms | taz; DDB_G0291922; Taffazin; Taz; 1-acylglycerophosphocholine O-acyltransferase |
UniProt ID | Q54DX7 |
◆ Recombinant Proteins | ||
Taz-1229R | Recombinant Rat Taz protein, His-tagged | +Inquiry |
TAZ-4629R | Recombinant Rhesus monkey TAZ Protein, His-tagged | +Inquiry |
TAZ-1227H | Recombinant Human TAZ protein, His & T7-tagged | +Inquiry |
TAZ-6398H | Recombinant Human TAZ Protein (Gly154-Arg292), N-His tagged | +Inquiry |
TAZ-522HF | Recombinant Full Length Human TAZ Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TAZ-1234HCL | Recombinant Human TAZ 293 Cell Lysate | +Inquiry |
TAZ-1233HCL | Recombinant Human TAZ 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All taz Products
Required fields are marked with *
My Review for All taz Products
Required fields are marked with *