Recombinant Full Length Dictyostelium Discoideum Signal Recognition Particle Receptor Subunit Beta(Srprb) Protein, His-Tagged
Cat.No. : | RFL2001DF |
Product Overview : | Recombinant Full Length Dictyostelium discoideum Signal recognition particle receptor subunit beta(srprb) Protein (Q54XX1) (1-290aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dictyostelium Discoideum |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-290) |
Form : | Lyophilized powder |
AA Sequence : | MKDSAILNQLKVVLPPHIMEIIYFRYNQIDTYLKPYNLPIKTDVLLLALFTLIFIIIISK LFGSSGNKTRSVGGRTSNDKKVKRGVNIAILGLSNAGKTALLLNLTNVDKKISTHTSITT NNGVYITENKKKLPIIDVPGNGKAKASLPKILSNSACIIYVIDGTTFIDNSTQEAQYLYD ILTNESVYQKKIPVLVFNNKMDLDSTIDTEQVKNILERELDDLRRTRGATPIVLGQEEDK KDIYLGIEGTPFQFDHLPNDVQFSNGSASPSNGELKEIDDIKNFIQTTTL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | srprb |
Synonyms | srprb; DDB_G0278543; Signal recognition particle receptor subunit beta; SR-beta |
UniProt ID | Q54XX1 |
◆ Recombinant Proteins | ||
SRPRB-691Z | Recombinant Zebrafish SRPRB | +Inquiry |
SRPRB-2257H | Recombinant Human SRPRB Protein, Flag-tagged | +Inquiry |
SRPRB-3430H | Recombinant Human SRPRB protein, His-tagged | +Inquiry |
Srprb-6134M | Recombinant Mouse Srprb Protein, Myc/DDK-tagged | +Inquiry |
SRPRB-15999M | Recombinant Mouse SRPRB Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SRPRB-1473HCL | Recombinant Human SRPRB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All srprb Products
Required fields are marked with *
My Review for All srprb Products
Required fields are marked with *
0
Inquiry Basket