Recombinant Full Length Dictyostelium Discoideum Sugar Transporter Sweet1(Slc50A1) Protein, His-Tagged
Cat.No. : | RFL26624DF |
Product Overview : | Recombinant Full Length Dictyostelium discoideum Sugar transporter SWEET1(slc50a1) Protein (Q54JW5) (1-220aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dictyostelium Discoideum |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-220) |
Form : | Lyophilized powder |
AA Sequence : | MEDEKNENLMTFIQFCATFITITLFIMPLKTIRLIIEKKNVGTVAGLQFISSVLNCFLWI SYALLTSNTTMLFVNSIGMMFSIYYVFNYWKNINQVRASRDYLKKVMIACVLAITIISIS YYNTVDDLDTRISRLGFLSSVVCVLMFASPLEKMAIVIQSKNSEGMIINVAILSLLCGLS WTIFGLLLNDIYIYLPNILASILSFVQLTLIKLYPPQILL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | slc50a1 |
Synonyms | slc50a1; DDB_G0287763; Sugar transporter SWEET1 |
UniProt ID | Q54JW5 |
◆ Recombinant Proteins | ||
SLC50A1-5215R | Recombinant Rat SLC50A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL1723DF | Recombinant Full Length Danio Rerio Sugar Transporter Sweet1(Slc50A1) Protein, His-Tagged | +Inquiry |
RFL21549MF | Recombinant Full Length Mouse Sugar Transporter Sweet1(Slc50A1) Protein, His-Tagged | +Inquiry |
SLC50A1-2056Z | Recombinant Zebrafish SLC50A1 | +Inquiry |
SLC50A1-8392M | Recombinant Mouse SLC50A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC50A1-2548HCL | Recombinant Human RAG1AP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All slc50a1 Products
Required fields are marked with *
My Review for All slc50a1 Products
Required fields are marked with *