Recombinant Full Length Dictyostelium Discoideum Superoxide-Generating Nadph Oxidase Light Chain Subunit(Cyba) Protein, His-Tagged
| Cat.No. : | RFL34531DF |
| Product Overview : | Recombinant Full Length Dictyostelium discoideum Superoxide-generating NADPH oxidase light chain subunit(cybA) Protein (Q867X6) (1-118aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Dictyostelium Discoideum |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-118) |
| Form : | Lyophilized powder |
| AA Sequence : | MGKFKLGNWAAMIGMAACWCLIAGGIMGIWYERRYIAIYSICVGGVLYPLLYPLSFLGPL KAIFHQYYVAAALMAGLSVLCYFLVPTMLAAMVMDISAVVFLISAIKGERGDFFDKQD |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | cybA |
| Synonyms | cybA; DDB_G0267460; Superoxide-generating NADPH oxidase light chain subunit; Cytochrome b-245 light chain; p22-phox; p22phox |
| UniProt ID | Q867X6 |
| ◆ Recombinant Proteins | ||
| CYBA-1365R | Recombinant Rat CYBA Protein, His (Fc)-Avi-tagged | +Inquiry |
| RFL34531DF | Recombinant Full Length Dictyostelium Discoideum Superoxide-Generating Nadph Oxidase Light Chain Subunit(Cyba) Protein, His-Tagged | +Inquiry |
| CYBA-2221H | Recombinant Human CYBA Protein, GST-tagged | +Inquiry |
| CYBA-1706R | Recombinant Rat CYBA Protein | +Inquiry |
| CYBA-2386HF | Recombinant Full Length Human CYBA Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CYBA-7139HCL | Recombinant Human CYBA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All cybA Products
Required fields are marked with *
My Review for All cybA Products
Required fields are marked with *
