Recombinant Full Length Dictyostelium Discoideum Transmembrane Protein 111 Homolog(Tmem111) Protein, His-Tagged
Cat.No. : | RFL30417DF |
Product Overview : | Recombinant Full Length Dictyostelium discoideum Transmembrane protein 111 homolog(tmem111) Protein (Q54YN3) (1-314aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dictyostelium Discoideum |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-314) |
Form : | Lyophilized powder |
AA Sequence : | MTESPIVLDVEIRNWVVIPILIVLFIVSALKLNISRIMQINSGKPQDVEKTMQMQTINRV RRLVSFYNRIPQKSFFIRKAYLCGTTGSKTNKGILSSIAPTQEDSNPMNMMFANSMFTDP SGITDMLKGNIMHLIPQVTMMSWVNHFFSGFVACKLPFFPLTIRFKTFLQRGIEMGSLDV SYVSSLSWYFLCWFGSEGINAILLGENMVSADSQLLQSSIEPGPPTQQTPIHKIYASEKE NIEMIRYDSLMTNIEDRFLDNIKKKTSFDFNQINKNNNNNNNNTSNIKPKPIKSNLSNSK QSKRITYQKPSSLI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | emc3 |
Synonyms | emc3; tmem111; DDB_G0278153; ER membrane protein complex subunit 3; Transmembrane protein 111 |
UniProt ID | Q54YN3 |
◆ Recombinant Proteins | ||
EMC3-12667Z | Recombinant Zebrafish EMC3 | +Inquiry |
RFL26827MF | Recombinant Full Length Mouse Transmembrane Protein 111(Tmem111) Protein, His-Tagged | +Inquiry |
RFL32059HF | Recombinant Full Length Human Transmembrane Protein 111(Tmem111) Protein, His-Tagged | +Inquiry |
EMC3-2763M | Recombinant Mouse EMC3 Protein, His (Fc)-Avi-tagged | +Inquiry |
EMC3-5163M | Recombinant Mouse EMC3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
EMC3-1012HCL | Recombinant Human TMEM111 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All emc3 Products
Required fields are marked with *
My Review for All emc3 Products
Required fields are marked with *