Recombinant Full Length Dictyostelium Discoideum Transmembrane Protein 208 Homolog(Tmem208) Protein, His-Tagged
Cat.No. : | RFL27643DF |
Product Overview : | Recombinant Full Length Dictyostelium discoideum Transmembrane protein 208 homolog(tmem208) Protein (Q54UB0) (1-173aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dictyostelium Discoideum |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-173) |
Form : | Lyophilized powder |
AA Sequence : | MANSGAKKRKTQNEKELFKVRLIMAAGTIPYILYRVVYHSETFGGWLWFAYLSLNALNMF AYYIITSMCKLTYDNNGELIDGGSDLNQGGMTEYYFDIIYVCCIIQGLGLISDKCLYLIL VIPAFAIFKIWKTFIGPYLASRNQQQQQPQEEKSKRREKMEKKQEKQKVKYVK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | tmem208 |
Synonyms | tmem208; DDB_G0281177; Transmembrane protein 208 homolog |
UniProt ID | Q54UB0 |
◆ Recombinant Proteins | ||
TMEM208-5266H | Recombinant Human TMEM208 Protein, GST-tagged | +Inquiry |
Tmem208-6488M | Recombinant Mouse Tmem208 Protein, Myc/DDK-tagged | +Inquiry |
TMEM208-4594C | Recombinant Chicken TMEM208 | +Inquiry |
TMEM208-4941H | Recombinant Human TMEM208 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TMEM208-4619R | Recombinant Rhesus Macaque TMEM208 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMEM208-967HCL | Recombinant Human TMEM208 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All tmem208 Products
Required fields are marked with *
My Review for All tmem208 Products
Required fields are marked with *
0
Inquiry Basket