Recombinant Full Length Dog Mitochondrial Uncoupling Protein 2(Ucp2) Protein, His-Tagged
| Cat.No. : | RFL35520CF |
| Product Overview : | Recombinant Full Length Dog Mitochondrial uncoupling protein 2(UCP2) Protein (Q9N2J1) (1-309aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Dog |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-309) |
| Form : | Lyophilized powder |
| AA Sequence : | MVGFKATDVPPTATVKFLGAGTAACIADLITFPLDTAKVRLQIQGERQGPVRAAASAQYR GVLCTILTMVRTEGPRSLYSGLVAGLQRQMSFASVRIGLYDSVKQFYTKGSEHAGIGSRL LAGSTTGALAVAVAQPTDVVKVRFQAQARAGSGRRYQSTVDAYKTIAREEGFRGLWKGTS PNVARNAIVNCAELVTYDLIKDALLKANLMTDDLPCHFTSAFGAGFCTTVIASPVDVVKT RYMNSALGQYSSAGHCALTMLQKEGPRAFYKGFMPSFLRLGSWNVVMFVTYEQLKRALMA ACTSREAPF |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | UCP2 |
| Synonyms | UCP2; SLC25A8; Mitochondrial uncoupling protein 2; UCP 2; Solute carrier family 25 member 8 |
| UniProt ID | Q9N2J1 |
| ◆ Recombinant Proteins | ||
| RFL10275PF | Recombinant Full Length Pongo Abelii Mitochondrial Uncoupling Protein 2(Ucp2) Protein, His-Tagged | +Inquiry |
| UCP2-1963HFL | Recombinant Full Length Human UCP2 Protein, N-His-tagged | +Inquiry |
| Ucp2-7918R | Recombinant Rat Ucp2 protein, His-tagged | +Inquiry |
| UCP2-17790M | Recombinant Mouse UCP2 Protein | +Inquiry |
| RFL26536DF | Recombinant Full Length Danio Rerio Mitochondrial Uncoupling Protein 2(Ucp2) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| UCP2-525HCL | Recombinant Human UCP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UCP2 Products
Required fields are marked with *
My Review for All UCP2 Products
Required fields are marked with *




