Recombinant Full Length Dog Solute Carrier Family 2, Facilitated Glucose Transporter Member 4(Slc2A4) Protein, His-Tagged
| Cat.No. : | RFL28664CF |
| Product Overview : | Recombinant Full Length Dog Solute carrier family 2, facilitated glucose transporter member 4(SLC2A4) Protein (Q9XST2) (1-162aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Dog |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-162) |
| Form : | Lyophilized powder |
| AA Sequence : | TSIFETAGVGQPAYATIGAGVVNTVFTLVSVFLVERAGRRTLHLLGLAGMCGCAILMTIA LLLLERLPAMSYVSIVAIFGFVAFFEIGPGPIPWFIVAELFSQGPRPAAMAVAGFCNWTS NFIIGMGFQYIAXAMGPYVFLLFAVLLLAFFIFTFLKVPETR |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | SLC2A4 |
| Synonyms | SLC2A4; GLUT4; B146; Solute carrier family 2, facilitated glucose transporter member 4; Glucose transporter type 4, insulin-responsive; GLUT-4; Fragment |
| UniProt ID | Q9XST2 |
| ◆ Recombinant Proteins | ||
| Slc2a4-2695M | Recombinant Mouse Slc2a4 Protein, His&GST-tagged | +Inquiry |
| SLC2A4-8314M | Recombinant Mouse SLC2A4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SLC2A4-1644H | Recombinant Human SLC2A4 protein, His & GST-tagged | +Inquiry |
| SLC2A4-2657H | Recombinant Human SLC2A4 Protein (Cys223-Leu287), SUMO tagged | +Inquiry |
| Slc2a4-5920M | Recombinant Mouse Slc2a4 Protein, Myc/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC2A4 Products
Required fields are marked with *
My Review for All SLC2A4 Products
Required fields are marked with *



