Recombinant Full Length Dog T-Cell Surface Glycoprotein Cd3 Epsilon Chain(Cd3E) Protein, His-Tagged
Cat.No. : | RFL27268CF |
Product Overview : | Recombinant Full Length Dog T-cell surface glycoprotein CD3 epsilon chain(CD3E) Protein (P27597) (22-202aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dog |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (22-202) |
Form : | Lyophilized powder |
AA Sequence : | QDEDFKASDDLTSISPEKRFKVSISGTEVVVTCPDVFGYDNIKWEKNDNLVEGASNRELSQKEFSEVDDSGYYACYADSIKEKSYLYLRARVCANCIEVNLMAVVTIIVADICLTLGLLLMVYYWSKTRKANAKPVMRGTGAGSRPRGQNKEKPPPVPNPDYEPIRKGQQDLYSGLNQRGI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CD3E |
Synonyms | CD3E; T-cell surface glycoprotein CD3 epsilon chain; CD antigen CD3e |
UniProt ID | P27597 |
◆ Recombinant Proteins | ||
CD3E-3081C | Recombinant Canine CD3E protein, His-tagged | +Inquiry |
Cd3e-322R | Recombinant Rhesus CD3E Protein, His-tagged | +Inquiry |
CD3E-204H | Recombinant Human CD3E Protein, Fc\Avi-tagged | +Inquiry |
CD3E-143H | Recombinant Human CD3E Protein, Strep-tagged | +Inquiry |
CD3E-274C | Active Recombinant Cynomolgus CD3E, His-tagged, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD3E-1275HCL | Recombinant Human CD3E cell lysate | +Inquiry |
CD3E-1602CCL | Recombinant Cynomolgus CD3E cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD3E Products
Required fields are marked with *
My Review for All CD3E Products
Required fields are marked with *
0
Inquiry Basket