Recombinant Full Length Dog V-Type Proton Atpase Subunit E 1(Atp6V0E1) Protein, His-Tagged
| Cat.No. : | RFL8758CF |
| Product Overview : | Recombinant Full Length Dog V-type proton ATPase subunit e 1(ATP6V0E1) Protein (Q9BDP4) (2-81aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Dog |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length of Mature Protein (2-81) |
| Form : | Lyophilized powder |
| AA Sequence : | AYHGLTVPLIVMSVFWGFVGFCVPWFIPKGPNRGVIITMLVTCSVCCYLFWLIAILAQLN PLFGPQLKNETIWYLKYHWP |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | ATP6V0E1 |
| Synonyms | ATP6V0E1; ATP6H; ATP6V0E; V-type proton ATPase subunit e 1; V-ATPase subunit e 1; V-ATPase 9.2 kDa membrane accessory protein; V-ATPase M9.2 subunit; Vacuolar proton pump subunit e 1 |
| UniProt ID | Q9BDP4 |
| ◆ Recombinant Proteins | ||
| ATP6V0E1-544R | Recombinant Rat ATP6V0E1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| RFL11099MF | Recombinant Full Length Mouse V-Type Proton Atpase Subunit E 1(Atp6V0E1) Protein, His-Tagged | +Inquiry |
| ATP6V0E1-465R | Recombinant Rhesus monkey ATP6V0E1 Protein, His-tagged | +Inquiry |
| ATP6V0E-999H | Recombinant Human ATP6V0E protein, GST-tagged | +Inquiry |
| ATP6V0E1-1552Z | Recombinant Zebrafish ATP6V0E1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ATP6V0E1-8586HCL | Recombinant Human ATP6V0E1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATP6V0E1 Products
Required fields are marked with *
My Review for All ATP6V0E1 Products
Required fields are marked with *
