Recombinant Full Length Dugong Dugon Aquaporin-2(Aqp2) Protein, His-Tagged
Cat.No. : | RFL-34090DF |
Product Overview : | Recombinant Full Length Dugong dugon Aquaporin-2(AQP2) Protein (O77714) (1-109aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dugong dugon (Dugong) (Trichechus dugon) |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-109) |
Form : | Lyophilized powder |
AA Sequence : | SIAFSRAVFSEFLATLLFVFFGLGSALNWPQALPSVLQIAMAFGLAIGTLVQALGHISGAHINPAVTVACLVGCHVSFLRATFYLAAQLLGAVAGAAILHEITPPDIRG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | AQP2 |
Synonyms | AQP2; Aquaporin-2; AQP-2; ADH water channel; Aquaporin-CD; AQP-CD; Collecting duct water channel protein; WCH-CD; Water channel protein for renal collecting duct; Fragment |
UniProt ID | O77714 |
◆ Recombinant Proteins | ||
RFL-2233OF | Recombinant Full Length Orycteropus Afer Aquaporin-2(Aqp2) Protein, His-Tagged | +Inquiry |
AQP2-5516C | Recombinant Chicken AQP2 | +Inquiry |
RFL-28356OF | Recombinant Full Length Sheep Aquaporin-2(Aqp2) Protein, His-Tagged | +Inquiry |
RFL-8058CF | Recombinant Full Length Dog Aquaporin-2(Aqp2) Protein, His-Tagged | +Inquiry |
AQP2-201R | Recombinant Rhesus Macaque AQP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AQP2 Products
Required fields are marked with *
My Review for All AQP2 Products
Required fields are marked with *