Recombinant Full Length Goat Acyl-Coa Desaturase(Scd) Protein, His-Tagged
Cat.No. : | RFL4212CF |
Product Overview : | Recombinant Full Length Goat Acyl-CoA desaturase(SCD) Protein (Q95MI7) (2-359aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Goat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (2-359) |
Form : | Lyophilized powder |
AA Sequence : | PAHLLQEEISSSYTTTTTITAPPSKVLQNGGGKLEKTPLYLEEDIRPEMRDDIYDPTYQD KEGPKPKLEYVWRNIILMGLLHLGALYGITLIPTCKIYTFLWVLFYYMMSALGITAGVHR LWSHRTYKARLPLRVFLIIANTMAFQNDVFEWSRDHRAHHKFSETDADPHNSRRGFFFSH VGWLLVRKHPAVREKGATLDLSDLRAEKLVMFQRRYYKPGVLLLCFILPTLVPWYLWGET FQNSLFFATLLRYAVVLNATWLVNSAAHMYGYRPYDKTINPRENILVSLGAVGEGFHNYH HTFPYDYSASEYRWHINFTTFFIDCMAAIGLAYDRKKVSKAAALARMKRTGEESCKSG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SCD |
Synonyms | SCD; Stearoyl-CoA desaturase; Acyl-CoA desaturase; Delta(9-desaturase; Delta-9 desaturase; Fatty acid desaturase |
UniProt ID | Q95MI7 |
◆ Recombinant Proteins | ||
SCD-2394H | Recombinant Human SCD protein, His-tagged | +Inquiry |
SCD-3126H | Recombinant Human SCD, His-tagged | +Inquiry |
SCD-5246R | Recombinant Rat SCD Protein | +Inquiry |
RFL15797OF | Recombinant Full Length Sheep Acyl-Coa Desaturase(Scd) Protein, His-Tagged | +Inquiry |
RFL34573MF | Recombinant Full Length Mesocricetus Auratus Acyl-Coa Desaturase(Scd) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SCD-2044HCL | Recombinant Human SCD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SCD Products
Required fields are marked with *
My Review for All SCD Products
Required fields are marked with *
0
Inquiry Basket