Recombinant Full Length Gorilla Gorilla Gorilla Nadh Dehydrogenase [Ubiquinone] 1 Subunit C2(Ndufc2) Protein, His-Tagged
Cat.No. : | RFL12519GF |
Product Overview : | Recombinant Full Length Gorilla gorilla gorilla NADH dehydrogenase [ubiquinone] 1 subunit C2(NDUFC2) Protein (Q0MQF8) (1-119aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Gorilla gorilla gorilla (Western lowland gorilla) |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-119) |
Form : | Lyophilized powder |
AA Sequence : | MIARRNPEPLRFLPDEARSLPPPKLTDPRLLYIGFLGYCSGLIDNLIRRRPIATAGLHRQ LLYITAFFFAGYYLVKREDYLYAVRDREMFGYMKLHPEDFPEEDKKTYGEIFEKFHPIR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | NDUFC2 |
Synonyms | NDUFC2; NADH dehydrogenase [ubiquinone] 1 subunit C2; Complex I-B14.5b; CI-B14.5b; NADH-ubiquinone oxidoreductase subunit B14.5b |
UniProt ID | Q0MQF8 |
◆ Recombinant Proteins | ||
NDUFC2-737C | Recombinant Cynomolgus NDUFC2 Protein, His-tagged | +Inquiry |
NDUFC2-2806R | Recombinant Rhesus Macaque NDUFC2 Protein, His (Fc)-Avi-tagged | +Inquiry |
NDUFC2-5987M | Recombinant Mouse NDUFC2 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL24529BF | Recombinant Full Length Bovine Nadh Dehydrogenase [Ubiquinone] 1 Subunit C2(Ndufc2) Protein, His-Tagged | +Inquiry |
NDUFC2-481C | Recombinant Cynomolgus Monkey NDUFC2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NDUFC2-3899HCL | Recombinant Human NDUFC2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NDUFC2 Products
Required fields are marked with *
My Review for All NDUFC2 Products
Required fields are marked with *
0
Inquiry Basket