Recombinant Full Length Guinea Pig 5-Hydroxytryptamine Receptor 4(Htr4) Protein, His-Tagged
Cat.No. : | RFL13015CF |
Product Overview : | Recombinant Full Length Guinea pig 5-hydroxytryptamine receptor 4(HTR4) Protein (O70528) (1-388aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Guinea pig |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-388) |
Form : | Lyophilized powder |
AA Sequence : | MDKLDANVSSKEGFGSVEKVVLLTFLSAVILMAILGNLLVMVAVCRDRQLRKIKTNYFIV SLAFADLLVSVLVMPFGAIELVQDIWVYGEMFCLVRTSLDVLLTTASIFHLCCISLDRYY AICCQPLVYRNKMTPLRIALMLGGCWVIPMFISFLPIMQGWNNIGIVDLIEKRKFNQNSN STYCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHARQIQVLQRAGAPAEGRP QPADQHSTHRMRTETKAAKTLCIIMGCFCLCWAPFFVTNIVDPFIDYTVPGQLWTAFLWL GYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYRRPSILGQTVPCSTTTINGSTHVLRD TVECGGQWESQCHPAASSPLVAAQPIDT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HTR4 |
Synonyms | HTR4; 5-hydroxytryptamine receptor 4; 5-HT-4; 5-HT4; Serotonin receptor 4 |
UniProt ID | O70528 |
◆ Recombinant Proteins | ||
HTR4-5237H | Recombinant Human HTR4 Protein, GST-tagged | +Inquiry |
HTR4-4378M | Recombinant Mouse HTR4 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL8363MF | Recombinant Full Length Mouse 5-Hydroxytryptamine Receptor 4(Htr4) Protein, His-Tagged | +Inquiry |
HTR4-7937M | Recombinant Mouse HTR4 Protein | +Inquiry |
HTR4-3817H | Recombinant Human HTR4 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HTR4-829HCL | Recombinant Human HTR4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HTR4 Products
Required fields are marked with *
My Review for All HTR4 Products
Required fields are marked with *
0
Inquiry Basket