Recombinant Full Length Guinea Pig Inward Rectifier Potassium Channel 13(Kcnj13) Protein, His-Tagged
| Cat.No. : | RFL32303CF |
| Product Overview : | Recombinant Full Length Guinea pig Inward rectifier potassium channel 13(KCNJ13) Protein (Q9QZ65) (1-360aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Guinea pig |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-360) |
| Form : | Lyophilized powder |
| AA Sequence : | MESSNCKVITPLLSQRHRRMVTKDGHSTLQTDGAPRGLVYLRDAWGTLIDMRWRWVMLVF SASFVLHWLVFAVLWYVLAEMNGDLELDHDAPPENHTICVKYITSFTAAFSFSLETQLTI GYGTMFPSGDCPSAIALLAIQMLLGLMLEAFITGAFVAKIARPKNRAFSIRFTDLAVVAH RDGKPNLIFQVANIRHSPLTSVRVSAVLYQERENGQLHQTSVDFHLDGISSEECPFFIFP LTYYHSITPSSPLVTLLQHENPPHFELVVFLSAMQEGTGEICQRRTSYLPSEIMLHHCFA SLLTRGSKGEYKVKMENFDKTVPELPTPLVSKSPHRTDLDIRINGQSIDNFQISETGLTE |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | KCNJ13 |
| Synonyms | KCNJ13; Inward rectifier potassium channel 13; Inward rectifier K(+ channel Kir7.1; Potassium channel, inwardly rectifying subfamily J member 13 |
| UniProt ID | Q9QZ65 |
| ◆ Recombinant Proteins | ||
| RFL19487HF | Recombinant Full Length Human Inward Rectifier Potassium Channel 13(Kcnj13) Protein, His-Tagged | +Inquiry |
| KCNJ13-3197R | Recombinant Rat KCNJ13 Protein | +Inquiry |
| KCNJ13-4736M | Recombinant Mouse KCNJ13 Protein, His (Fc)-Avi-tagged | +Inquiry |
| RFL27001RF | Recombinant Full Length Rat Inward Rectifier Potassium Channel 13(Kcnj13) Protein, His-Tagged | +Inquiry |
| KCNJ13-8513M | Recombinant Mouse KCNJ13 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| KCNJ13-5048HCL | Recombinant Human KCNJ13 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KCNJ13 Products
Required fields are marked with *
My Review for All KCNJ13 Products
Required fields are marked with *
