Recombinant Full Length Human 5-Hydroxytryptamine Receptor 3B(Htr3B) Protein, His-Tagged
Cat.No. : | RFL20927HF |
Product Overview : | Recombinant Full Length Human 5-hydroxytryptamine receptor 3B(HTR3B) Protein (O95264) (22-441aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (22-441) |
Form : | Lyophilized powder |
AA Sequence : | TDTHHPQDSALYHLSKQLLQKYHKEVRPVYNWTKATTVYLDLFVHAILDVDAENQILKTS VWYQEVWNDEFLSWNSSMFDEIREISLPLSAIWAPDIIINEFVDIERYPDLPYVYVNSSG TIENYKPIQVVSACSLETYAFPFDVQNCSLTFKSILHTVEDVDLAFLRSPEDIQHDKKAF LNDSEWELLSVSSTYSILQSSAGGFAQIQFNVVMRRHPLVYVVSLLIPSIFLMLVDLGSF YLPPNCRARIVFKTSVLVGYTVFRVNMSNQVPRSVGSTPLIGHFFTICMAFLVLSLAKSI VLVKFLHDEQRGGQEQPFLCLRGDTDADRPRVEPRAQRAVVTESSLYGEHLAQPGTLKEV WSQLQSISNYLQTQDQTDQQEAEWLVLLSRFDRLLFQSYLFMLGIYTITLCSLWALWGGV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HTR3B |
Synonyms | HTR3B; 5-hydroxytryptamine receptor 3B; 5-HT3-B; 5-HT3B; Serotonin receptor 3B |
UniProt ID | O95264 |
◆ Recombinant Proteins | ||
RFL20927HF | Recombinant Full Length Human 5-Hydroxytryptamine Receptor 3B(Htr3B) Protein, His-Tagged | +Inquiry |
RFL1854MF | Recombinant Full Length Mouse 5-Hydroxytryptamine Receptor 3B(Htr3B) Protein, His-Tagged | +Inquiry |
HTR3B-7936M | Recombinant Mouse HTR3B Protein | +Inquiry |
HTR3B-5693HF | Recombinant Full Length Human HTR3B Protein | +Inquiry |
HTR3B-2621R | Recombinant Rat HTR3B Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HTR3B-828HCL | Recombinant Human HTR3B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HTR3B Products
Required fields are marked with *
My Review for All HTR3B Products
Required fields are marked with *
0
Inquiry Basket