Recombinant Full Length Human AAMDC Protein, GST-tagged

Cat.No. : AAMDC-1847HF
Product Overview : Human AAMDC full-length ORF (BAB14963.1, 1 a.a. - 122 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 122amino acids
Description : Predicted to be involved in positive regulation of fat cell differentiation. Predicted to act upstream of or within negative regulation of apoptotic process and positive regulation of transcription by RNA polymerase II. Predicted to be active in cytoplasm.
Form : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 39.7 kDa
AA Sequence : MTSPEIASLSWGQMKVKGSNTTYKDCKVWPGGSRTWDWRETGTEHSPGVQPADVKEVVEKGVQTLVIGRGMSEALKVPSSTVEYLKKHGIDVRVLQTEQAVKEYNALVAQGVRVGGVFHSTC
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name AAMDC adipogenesis associated Mth938 domain containing [ Homo sapiens (human) ]
Official Symbol AAMDC
Synonyms C11ORF67; chromosome 11 open reading frame 67; UPF0366 protein C11orf67; CK067; FLJ21035; PTD015; MGC3367
Gene ID 28971
mRNA Refseq NM_024684
Protein Refseq NP_078960
UniProt ID Q9H7C9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AAMDC Products

Required fields are marked with *

My Review for All AAMDC Products

Required fields are marked with *

0

Inquiry Basket

cartIcon