Recombinant Full Length Human AAMDC Protein, GST-tagged
Cat.No. : | AAMDC-1847HF |
Product Overview : | Human AAMDC full-length ORF (BAB14963.1, 1 a.a. - 122 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 122amino acids |
Description : | Predicted to be involved in positive regulation of fat cell differentiation. Predicted to act upstream of or within negative regulation of apoptotic process and positive regulation of transcription by RNA polymerase II. Predicted to be active in cytoplasm. |
Form : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 39.7 kDa |
AA Sequence : | MTSPEIASLSWGQMKVKGSNTTYKDCKVWPGGSRTWDWRETGTEHSPGVQPADVKEVVEKGVQTLVIGRGMSEALKVPSSTVEYLKKHGIDVRVLQTEQAVKEYNALVAQGVRVGGVFHSTC |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | AAMDC adipogenesis associated Mth938 domain containing [ Homo sapiens (human) ] |
Official Symbol | AAMDC |
Synonyms | C11ORF67; chromosome 11 open reading frame 67; UPF0366 protein C11orf67; CK067; FLJ21035; PTD015; MGC3367 |
Gene ID | 28971 |
mRNA Refseq | NM_024684 |
Protein Refseq | NP_078960 |
UniProt ID | Q9H7C9 |
◆ Recombinant Proteins | ||
AAMDC-333H | Recombinant Human AAMDC Protein, His-tagged | +Inquiry |
AAMDC-2394H | Recombinant Human AAMDC Protein, His (Fc)-Avi-tagged | +Inquiry |
AAMDC-1R | Recombinant Rhesus Macaque AAMDC Protein, His (Fc)-Avi-tagged | +Inquiry |
AAMDC-1283H | Recombinant Human AAMDC Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
AAMDC-172R | Recombinant Rhesus monkey AAMDC Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AAMDC Products
Required fields are marked with *
My Review for All AAMDC Products
Required fields are marked with *