Recombinant Full Length Human Abhydrolase Domain-Containing Protein 14A(Abhd14A) Protein, His-Tagged
| Cat.No. : | RFL15276HF |
| Product Overview : | Recombinant Full Length Human Abhydrolase domain-containing protein 14A(ABHD14A) Protein (Q9BUJ0) (1-271aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-271) |
| Form : | Lyophilized powder |
| AA Sequence : | MVGALCGCWFRLGGARPLIPLGPTVVQTSMSRSQVALLGLSLLLMLLLYVGLPGPPEQTS CLWGDPNVTVLAGLTPGNSPIFYREVLPLNQAHRVEVVLLHGKAFNSHTWEQLGTLQLLS QRGYRAVALDLPGFGNSAPSKEASTEAGRAALLERALRDLEVQNAVLVSPSLSGHYALPF LMRGHHQLHGFVPIAPTSTQNYTQEQFWAVKTPTLILYGELDHILARESLRQLRHLPNHS VVKLRNAGHACYLHKPQDFHLVLLAFLDHLP |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | ABHD14A |
| Synonyms | ABHD14A; UNQ1913/PRO4373; Protein ABHD14A; Alpha/beta hydrolase domain-containing protein 14A; Abhydrolase domain-containing protein 14A |
| UniProt ID | Q9BUJ0 |
| ◆ Recombinant Proteins | ||
| ABHD14A-419R | Recombinant Rat ABHD14A Protein | +Inquiry |
| Abhd14a-1468M | Recombinant Mouse Abhd14a Protein, Myc/DDK-tagged | +Inquiry |
| RFL24000MF | Recombinant Full Length Mouse Abhydrolase Domain-Containing Protein 14A(Abhd14A) Protein, His-Tagged | +Inquiry |
| ABHD14A-076H | Recombinant Human ABHD14A Protein, GST-Tagged | +Inquiry |
| ABHD14A-11798Z | Recombinant Zebrafish ABHD14A | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ABHD14A-9137HCL | Recombinant Human ABHD14A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ABHD14A Products
Required fields are marked with *
My Review for All ABHD14A Products
Required fields are marked with *
