Recombinant Full Length Human ACAA2 Protein, C-Flag-tagged
Cat.No. : | ACAA2-1365HFL |
Product Overview : | Recombinant Full Length Human ACAA2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The encoded protein catalyzes the last step of the mitochondrial fatty acid beta-oxidation spiral. Unlike most mitochondrial matrix proteins, it contains a non-cleavable amino-terminal targeting signal. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 41.7 kDa |
AA Sequence : | MALLRGVFVVAAKRTPFGAYGGLLKDFTATDLSEFAAKAALSAGKVSPETVDSVIMGNVLQSSSDAIYLA RHVGLRVGIPKETPALTINRLCGSGFQSIVNGCQEICVKEAEVVLCGGTESMSQAPYCVRNVRFGTKLGS DIKLEDSLWVSLTDQHVQLPMAMTAENLAVKHKISREECDKYALQSQQRWKAANDAGYFNDEMAPIEVKT KKGKQTMQVDEHARPQTTLEQLQKLPPVFKKDGTVTAGNASGVADGAGAVIIASEDAVKKHNFTPLARIV GYFVSGCDPSIMGIGPVPAISGALKKAGLSLKDMDLVEVNEAFAPQYLAVERSLDLDISKTNVNGGAIAL GHPLGGSGSRITAHLVHELRRRGGKYAVGSACIGGGQGIAVIIQSTATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Fatty acid elongation in mitochondria, Fatty acid metabolism, Metabolic pathways, Valine, leucine and isoleucine degradation |
Full Length : | Full L. |
Gene Name | ACAA2 acetyl-CoA acyltransferase 2 [ Homo sapiens (human) ] |
Official Symbol | ACAA2 |
Synonyms | DSAEC |
Gene ID | 10449 |
mRNA Refseq | NM_006111.3 |
Protein Refseq | NP_006102.2 |
MIM | 604770 |
UniProt ID | P42765 |
◆ Recombinant Proteins | ||
Acaa2-8155M | Recombinant Mouse Acaa2 protein, His & T7-tagged | +Inquiry |
ACAA2-124H | Recombinant Human ACAA2 Protein, GST-Tagged | +Inquiry |
ACAA2-434R | Recombinant Rat ACAA2 Protein | +Inquiry |
ACAA2-7576H | Recombinant Human ACAA2, His-tagged | +Inquiry |
ACAA2-719H | Recombinant Human ACAA2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACAA2-9118HCL | Recombinant Human ACAA2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACAA2 Products
Required fields are marked with *
My Review for All ACAA2 Products
Required fields are marked with *
0
Inquiry Basket