Recombinant Full Length Human ACAT2 Protein, C-Flag-tagged
Cat.No. : | ACAT2-1055HFL |
Product Overview : | Recombinant Full Length Human ACAT2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The product of this gene is an enzyme involved in lipid metabolism, and it encodes cytosolic acetoacetyl-CoA thiolase. This gene shows complementary overlapping with the 3-prime region of the TCP1 gene in both mouse and human. These genes are encoded on opposite strands of DNA, as well as in opposite transcriptional orientation. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 41.2 kDa |
AA Sequence : | MNAGSDPVVIVSAARTIIGSFNGALAAVPVQDLGSTVIKEVLKRATVAPEDVSEVIFGHVLAAGCGQNPV RQASVGAGIPYSVPAWSCQMICGSGLKAVCLAVQSIGIGDSSIVVAGGMENMSKAPHLAYLRTGVKIGEM PLTDSILCDGLTDAFHNCHMGITAENVAKKWQVSREDQDKVAVLSQNRTENAQKAGHFDKEIVPVLVSTR RGLIEVKTDEFPRHGSNIEAMSKLKPYFLTDGTGTVTPANASGINDGAAAVVLMKKSEADKRGLTPLARI VSWSQVGVEPSIMGIGPIPAIKQAVTKAGWSLEDVDIFEINEAFAAVSAAIVKELGLNPEKVNIEGGAIA LGHPLGASGCRILVTLLHTLERMGRSRGVAALCIGGGMGIAMCVQRETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Butanoate metabolism, Fatty acid metabolism, Lysine degradation, Metabolic pathways, Propanoate metabolism, Pyruvate metabolism, Synthesis and degradation of ketone bodies, Terpenoid backbone biosynthesis, Tryptophan metabolism, Valine, leucine and isoleucine degradation |
Full Length : | Full L. |
Gene Name | ACAT2 acetyl-CoA acetyltransferase 2 [ Homo sapiens (human) ] |
Official Symbol | ACAT2 |
Synonyms | acetoacetyl Coenzyme A thiolase; acetyl-Coenzyme A acetyltransferase 2; cytosolic acetoacetyl-CoA thiolase; OTTHUMP00000017527 |
Gene ID | 39 |
mRNA Refseq | NM_005891.3 |
Protein Refseq | NP_005882.2 |
MIM | 100678 |
UniProt ID | Q9BWD1 |
◆ Recombinant Proteins | ||
Acat2-291E | Recombinant Rat Acat2 protein(Met1-Gly397), His-tagged | +Inquiry |
ACAT2-9277H | Recombinant Human ACAT2 protein, GST-tagged | +Inquiry |
ACAT2-1055HFL | Recombinant Full Length Human ACAT2 Protein, C-Flag-tagged | +Inquiry |
ACAT2-0178H | Recombinant Human ACAT2 Protein (Met1-Glu397), N-His-tagged | +Inquiry |
ACAT2-1170M | Recombinant Mouse ACAT2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACAT2-9108HCL | Recombinant Human ACAT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ACAT2 Products
Required fields are marked with *
My Review for All ACAT2 Products
Required fields are marked with *
0
Inquiry Basket