Recombinant Full Length Human ACKR1 Protein, C-Flag-tagged
| Cat.No. : | ACKR1-155HFL |
| Product Overview : | Recombinant Full Length Human ACKR1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | The protein encoded by this gene is a glycosylated membrane protein and a non-specific receptor for several chemokines. The encoded protein is the receptor for the human malarial parasites Plasmodium vivax and Plasmodium knowlesi. Polymorphisms in this gene are the basis of the Duffy blood group system. Two transcript variants encoding different isoforms have been found for this gene. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 35.4 kDa |
| AA Sequence : | MGNCLHRAELSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYGANLEAAAPCHSCNLLDDSALPFFILTSV LGILASSTVLFMLFRPLFRWQLCPGWPVLAQLAVGSALFSIVVPVLAPGLGSTRSSALCSLGYCVWYGSA FAQALLLGCHASLGHRLGAGQVPGLTLGLTVGIWGVAALLTLPVTLASGASGGLCTLIYSTELKALQATH TVACLAIFVLLPLGLFGAKGLKKALGMGPGPWMNILWAWFIFWWPHGVVLGLDFLVRSKLLLLSTCLAQQ ALDLLLNLAEALAILHCVATPLLLALFCHQATRTLLPSLPLPEGWFSHLDTLGSKSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Protein Families : | Druggable Genome, GPCR, Transmembrane |
| Full Length : | Full L. |
| Gene Name | ACKR1 atypical chemokine receptor 1 (Duffy blood group) [ Homo sapiens (human) ] |
| Official Symbol | ACKR1 |
| Synonyms | FY; Dfy; GPD; DARC; GpFy; CCBP1; CD234; WBCQ1; DARC/ACKR1 |
| Gene ID | 2532 |
| mRNA Refseq | NM_002036.4 |
| Protein Refseq | NP_002027.2 |
| MIM | 613665 |
| UniProt ID | Q16570 |
| ◆ Recombinant Proteins | ||
| ACKR1-913H | Recombinant Human ACKR1 Protein, MYC/DDK-tagged | +Inquiry |
| ACKR1-01H | Active Recombinant Human ACKR1 Full Length Transmembrane protein, His-tagged | +Inquiry |
| RFL3381HF | Recombinant Full Length Human Atypical Chemokine Receptor 1(Ackr1) (Active) Protein, His-Tagged | +Inquiry |
| Ackr1-1495M | Recombinant Mouse Ackr1 Protein, Myc/DDK-tagged | +Inquiry |
| ACKR1-2513HF | Recombinant Full Length Human ACKR1 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACKR1 Products
Required fields are marked with *
My Review for All ACKR1 Products
Required fields are marked with *
