Recombinant Full Length Human ADAT2 Protein, GST-tagged
| Cat.No. : | ADAT2-2409HF |
| Product Overview : | Human DEADC1 full-length ORF ( ENSP00000356566, 1 a.a. - 144 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 144 amino acids |
| Description : | ADAT2 (Adenosine Deaminase, TRNA Specific 2) is a Protein Coding gene. Among its related pathways are Gene Expression and tRNA processing. GO annotations related to this gene include hydrolase activity and tRNA-specific adenosine deaminase activity. |
| Molecular Mass : | 42.5 kDa |
| AA Sequence : | MVYNNEVVGKGRNEVNQTKNATRHAEMVAIDQVLDWCRQSGKSPSEVFEHTVLYVTVEPCIMCAAALRLMKIPLVVYGCQNERFGGCGSVLNIASADLPNTGRPFQCIPGYRAEEAVEMLKTFYKQENPNAPKSKVRKKECQKS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ADAT2 adenosine deaminase, tRNA-specific 2 [ Homo sapiens ] |
| Official Symbol | ADAT2 |
| Synonyms | ADAT2; adenosine deaminase, tRNA-specific 2; adenosine deaminase, tRNA specific 2, TAD2 homolog (S. cerevisiae) , DEADC1, deaminase domain containing 1; tRNA-specific adenosine deaminase 2; dJ20N2.1; TAD2; tRNA specific adenosine deaminase 2 homolog (S. cerevisiae); deaminase domain containing 1; deaminase domain-containing protein 1; tRNA-specific adenosine deaminase 2 homolog; adenosine deaminase, tRNA-specific 2, TAD2 homolog; tRNA-specific adenosine-34 deaminase subunit ADAT2; DEADC1; dJ20N2; |
| Gene ID | 134637 |
| mRNA Refseq | NM_182503 |
| Protein Refseq | NP_872309 |
| MIM | 615388 |
| UniProt ID | Q7Z6V5 |
| ◆ Recombinant Proteins | ||
| ADAT2-1334M | Recombinant Mouse ADAT2 Protein | +Inquiry |
| ADAT2-2409HF | Recombinant Full Length Human ADAT2 Protein, GST-tagged | +Inquiry |
| ADAT2-5392Z | Recombinant Zebrafish ADAT2 | +Inquiry |
| ADAT2-1142H | Recombinant Human ADAT2 Protein, MYC/DDK-tagged | +Inquiry |
| ADAT2-331M | Recombinant Mouse ADAT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADAT2 Products
Required fields are marked with *
My Review for All ADAT2 Products
Required fields are marked with *
